GPD1 antibody

Name GPD1 antibody
Supplier Fitzgerald
Catalog 70R-3143
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen GPD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGP
Purity/Format Affinity purified
Blocking Peptide GPD1 Blocking Peptide
Description Rabbit polyclonal GPD1 antibody
Gene GPD1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.