FBXO3 antibody

Name FBXO3 antibody
Supplier Fitzgerald
Catalog 70R-2790
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human, Mouse, Rat, Dog
Antigen FBXO3 antibody was raised using the N terminal of FBXO3 corresponding to a region with amino acids DDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTAAGGFQQRQG
Purity/Format Affinity purified
Blocking Peptide FBXO3 Blocking Peptide
Description Rabbit polyclonal FBXO3 antibody raised against the N terminal of FBXO3
Gene FBXO3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.