| Name | HSPA8 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4109 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog, Arabidopsis thaliana, C. elegans, Drosophila |
| Antigen | HSPA8 antibody was raised using the N terminal of HSPA8 corresponding to a region with amino acids VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE |
| Purity/Format | Affinity purified |
| Blocking Peptide | HSPA8 Blocking Peptide |
| Description | Rabbit polyclonal HSPA8 antibody raised against the N terminal of HSPA8 |
| Gene | HSPA8 |
| Supplier Page | Shop |