| Name | CENPA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2154 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | CENPA antibody was raised using the middle region of CENPA corresponding to a region with amino acids ALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG |
| Purity/Format | Affinity purified |
| Blocking Peptide | CENPA Blocking Peptide |
| Description | Rabbit polyclonal CENPA antibody raised against the middle region of CENPA |
| Gene | CENPA |
| Supplier Page | Shop |