| Name | WDR12 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1063 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | WDR12 antibody was raised using the C terminal of WDR12 corresponding to a region with amino acids DTRSCKAPLYDLAAHEDKVLSVDWTDTGLLLSGGADNKLYSYRYSPTTSH |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | WDR12 Blocking Peptide |
| Description | Rabbit polyclonal WDR12 antibody raised against the C terminal of WDR12 |
| Gene | WDR12 |
| Supplier Page | Shop |