TSPYL6 antibody

Name TSPYL6 antibody
Supplier Fitzgerald
Catalog 70R-1994
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen TSPYL6 antibody was raised using the N terminal of TSPYL6 corresponding to a region with amino acids MSLPESPHSPATLDYALEDPHQGQRSREKSKATEVMADMFDGRLEPIVFP
Purity/Format Affinity purified
Blocking Peptide TSPYL6 Blocking Peptide
Description Rabbit polyclonal TSPYL6 antibody raised against the N terminal of TSPYL6
Gene TSPYL6
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.