KREMEN1 antibody

Name KREMEN1 antibody
Supplier Fitzgerald
Catalog 70R-6267
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen KREMEN1 antibody was raised using the N terminal of KREMEN1 corresponding to a region with amino acids LKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPG
Purity/Format Affinity purified
Blocking Peptide KREMEN1 Blocking Peptide
Description Rabbit polyclonal KREMEN1 antibody raised against the N terminal of KREMEN1
Gene KREMEN1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.