| Name | PCDHGA4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6139 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PCDHGA4 antibody was raised using the N terminal of PCDHGA4 corresponding to a region with amino acids GDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVRENVPVGTRLLTVKAT |
| Purity/Format | Affinity purified |
| Blocking Peptide | PCDHGA4 Blocking Peptide |
| Description | Rabbit polyclonal PCDHGA4 antibody raised against the N terminal of PCDHGA4 |
| Gene | PCDHGA4 |
| Supplier Page | Shop |