| Name | RPL13A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3024 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RPL13A antibody was raised using the middle region of RPL13A corresponding to a region with amino acids HEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKY |
| Purity/Format | Affinity purified |
| Blocking Peptide | RPL13A Blocking Peptide |
| Description | Rabbit polyclonal RPL13A antibody raised against the middle region of RPL13A |
| Gene | RPL13A |
| Supplier Page | Shop |