Name | WDR4 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2223 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | WDR4 antibody was raised using the N terminal of WDR4 corresponding to a region with amino acids FIYDCSAAEKKSQENKGEDAPLDQGSGAILASTFSKSGSYFALTDDSKRL |
Purity/Format | Affinity purified |
Blocking Peptide | WDR4 Blocking Peptide |
Description | Rabbit polyclonal WDR4 antibody raised against the N terminal of WDR4 |
Gene | WDR4 |
Supplier Page | Shop |