| Name | MTHFSD antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1453 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Dog |
| Antigen | MTHFSD antibody was raised using the N terminal of MTHFSD corresponding to a region with amino acids EVKVDPDKPLEGVRLLVLQSKKTLLVPTPRLRTGLFNKITPPPGATKDIL |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | MTHFSD Blocking Peptide |
| Description | Rabbit polyclonal MTHFSD antibody raised against the N terminal of MTHFSD |
| Gene | MTHFSD |
| Supplier Page | Shop |