| Name | GEM antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5974 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | GEM antibody was raised using the N terminal of GEM corresponding to a region with amino acids KEPHQYSHRNRHSATPEDHCRRSWSSDSTDSVISSESGNTYYRVVLIGEQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | GEM Blocking Peptide |
| Description | Rabbit polyclonal GEM antibody raised against the N terminal of GEM |
| Gene | GEM |
| Supplier Page | Shop |