| Name | CBLN4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5300 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | CBLN4 antibody was raised using the C terminal of CBLN4 corresponding to a region with amino acids HVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDK |
| Purity/Format | Affinity purified |
| Blocking Peptide | CBLN4 Blocking Peptide |
| Description | Rabbit polyclonal CBLN4 antibody raised against the C terminal of CBLN4 |
| Gene | CBLN4 |
| Supplier Page | Shop |