DHX34 antibody

Name DHX34 antibody
Supplier Fitzgerald
Catalog 70R-4754
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen DHX34 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPGRLFPITVVYQPQEAEPTTSKSEKLDPRPFLRVLESIDHKYPPEERGD
Purity/Format Affinity purified
Blocking Peptide DHX34 Blocking Peptide
Description Rabbit polyclonal DHX34 antibody
Gene DHX34
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.