| Name | LRP2BP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3858 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | LRP2BP antibody was raised using the middle region of LRP2BP corresponding to a region with amino acids RSNEEAERLWLIAADNGNPKASVKAQSMLGLYYSTKEPKELEKAFYWHSE |
| Purity/Format | Affinity purified |
| Blocking Peptide | LRP2BP Blocking Peptide |
| Description | Rabbit polyclonal LRP2BP antibody raised against the middle region of LRP2BP |
| Gene | ANKRD37 |
| Supplier Page | Shop |