Name | CARKD antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7362 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | CARKD antibody was raised using the middle region of CARKD corresponding to a region with amino acids RLHALVVGPGLGRDDALLRNVQGILEVSKARDIPVVIDADGLWLVAQQPA |
Purity/Format | Affinity purified |
Blocking Peptide | CARKD Blocking Peptide |
Description | Rabbit polyclonal CARKD antibody raised against the middle region of CARKD |
Gene | CARKD |
Supplier Page | Shop |