| Name | CARKD antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7362 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | CARKD antibody was raised using the middle region of CARKD corresponding to a region with amino acids RLHALVVGPGLGRDDALLRNVQGILEVSKARDIPVVIDADGLWLVAQQPA |
| Purity/Format | Affinity purified |
| Blocking Peptide | CARKD Blocking Peptide |
| Description | Rabbit polyclonal CARKD antibody raised against the middle region of CARKD |
| Gene | CARKD |
| Supplier Page | Shop |