| Name | SURF6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1325 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | SURF6 antibody was raised using the middle region of SURF6 corresponding to a region with amino acids EPREPPGLIFNKVEVSEDEPASKAQRRKEKRQRVKGNLTPLTGRNYRQLL |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | SURF6 Blocking Peptide |
| Description | Rabbit polyclonal SURF6 antibody raised against the middle region of SURF6 |
| Gene | SURF6 |
| Supplier Page | Shop |