Name | SURF6 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1325 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | IHC WB |
Species Reactivities | Human |
Antigen | SURF6 antibody was raised using the middle region of SURF6 corresponding to a region with amino acids EPREPPGLIFNKVEVSEDEPASKAQRRKEKRQRVKGNLTPLTGRNYRQLL |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | SURF6 Blocking Peptide |
Description | Rabbit polyclonal SURF6 antibody raised against the middle region of SURF6 |
Gene | SURF6 |
Supplier Page | Shop |