FBXO28 antibody

Name FBXO28 antibody
Supplier Fitzgerald
Catalog 70R-3153
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen FBXO28 antibody was raised using the middle region of FBXO28 corresponding to a region with amino acids ELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLRKSKRLRNRK
Purity/Format Affinity purified
Blocking Peptide FBXO28 Blocking Peptide
Description Rabbit polyclonal FBXO28 antibody raised against the middle region of FBXO28
Gene FBXO28
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.