| Name | PSAT1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3185 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | PSAT1 antibody was raised using the N terminal of PSAT1 corresponding to a region with amino acids ADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASY |
| Purity/Format | Affinity purified |
| Blocking Peptide | PSAT1 Blocking Peptide |
| Description | Rabbit polyclonal PSAT1 antibody raised against the N terminal of PSAT1 |
| Gene | PSAT1 |
| Supplier Page | Shop |