| Name | PCGF5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3094 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PCGF5 antibody was raised using the N terminal of PCGF5 corresponding to a region with amino acids ATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSN |
| Purity/Format | Affinity purified |
| Blocking Peptide | PCGF5 Blocking Peptide |
| Description | Rabbit polyclonal PCGF5 antibody raised against the N terminal of PCGF5 |
| Gene | PCGF5 |
| Supplier Page | Shop |