HNRPLL antibody

Name HNRPLL antibody
Supplier Fitzgerald
Catalog 70R-1458
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human, Dog
Antigen HNRPLL antibody was raised using the N terminal of HNRPLL corresponding to a region with amino acids RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHHKVS
Purity/Format Total IgG Protein A purified
Blocking Peptide HNRPLL Blocking Peptide
Description Rabbit polyclonal HNRPLL antibody raised against the N terminal of HNRPLL
Gene HNRNPLL
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.