| Name | HNRPLL antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1458 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Dog |
| Antigen | HNRPLL antibody was raised using the N terminal of HNRPLL corresponding to a region with amino acids RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHHKVS |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | HNRPLL Blocking Peptide |
| Description | Rabbit polyclonal HNRPLL antibody raised against the N terminal of HNRPLL |
| Gene | HNRNPLL |
| Supplier Page | Shop |