Epsin 2 antibody

Name Epsin 2 antibody
Supplier Fitzgerald
Catalog 70R-2581
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen Epsin 2 antibody was raised using the middle region of EPN2 corresponding to a region with amino acids DPFESQPLTVASSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLN
Purity/Format Affinity purified
Blocking Peptide Epsin 2 Blocking Peptide
Description Rabbit polyclonal Epsin 2 antibody raised against the middle region of EPN2
Gene EPN2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.