Name | PDCD7 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6012 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | PDCD7 antibody was raised using the middle region of PDCD7 corresponding to a region with amino acids YLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWAT |
Purity/Format | Affinity purified |
Blocking Peptide | PDCD7 Blocking Peptide |
Description | Rabbit polyclonal PDCD7 antibody raised against the middle region of PDCD7 |
Gene | PDCD7 |
Supplier Page | Shop |