| Name | GJB1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1684 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | GJB1 antibody was raised using the C terminal of GJB1 corresponding to a region with amino acids GFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | GJB1 Blocking Peptide |
| Description | Rabbit polyclonal GJB1 antibody raised against the C terminal of GJB1 |
| Gene | GJB1 |
| Supplier Page | Shop |