C2orf25 antibody

Name C2orf25 antibody
Supplier Fitzgerald
Catalog 70R-4055
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen C2orf25 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSSGSDESHVAAAPPDICSRTVWPDETMGPFGPQDQRFQLPGNIGFDCHL
Purity/Format Affinity purified
Blocking Peptide C2orf25 Blocking Peptide
Description Rabbit polyclonal C2orf25 antibody
Gene MMADHC
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.