| Name | C2orf25 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4055 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C2orf25 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSSGSDESHVAAAPPDICSRTVWPDETMGPFGPQDQRFQLPGNIGFDCHL |
| Purity/Format | Affinity purified |
| Blocking Peptide | C2orf25 Blocking Peptide |
| Description | Rabbit polyclonal C2orf25 antibody |
| Gene | MMADHC |
| Supplier Page | Shop |