ZCCHC13 antibody

Name ZCCHC13 antibody
Supplier Fitzgerald
Catalog 70R-4279
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ZCCHC13 antibody was raised using the middle region of ZCCHC13 corresponding to a region with amino acids GKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQLLPLRQIPTSSQGMS
Purity/Format Affinity purified
Blocking Peptide ZCCHC13 Blocking Peptide
Description Rabbit polyclonal ZCCHC13 antibody raised against the middle region of ZCCHC13
Gene ZCCHC13
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.