Name | Anti-GPCR GPR87 antibody |
---|---|
Supplier | Abcam |
Catalog | ab104435 |
Prices | $370.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 1-50 ( MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLY L) of Human GPCR GPR87 (NP_076404) |
Description | Rabbit Polyclonal |
Gene | GPR87 |
Conjugate | Unconjugated |
Supplier Page | Shop |