Anti-GPCR GPR87 antibody
| Name | Anti-GPCR GPR87 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab104435 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 1-50 ( MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLY L) of Human GPCR GPR87 (NP_076404) |
| Description | Rabbit Polyclonal |
| Gene | GPR87 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-GPCR GPR87 antibody (ab104435) at 1 µg/ml + NCI-H226 cell lysate at 10 µg