Anti-GRPEL2 antibody
| Name | Anti-GRPEL2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85428 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | A synthetic peptide corresponding to a region within C terminal sequence 176-225 ( HEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQRRL ) of Human GRPEL2, NP_689620 Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | GRPEL2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-GRPEL2 antibody (ab85428) at 1 µg/ml (in 5% skim milk / PBS buffer) + fetal heart lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution