Anti-GSTM1 antibody
| Name | Anti-GSTM1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab108084 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Bovine |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 132-181 sequence (PEKLKLYSEFLGKRPWFAGNKGLEKISAYMKSSRFLPRPVFSKMAVWGN K) of human GSTM1 (NP_666533) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | GSTM1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
