Anti-H6PD antibody
| Name | Anti-H6PD antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab84353 |
| Prices | $376.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC-P |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 179-228 (HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGL W) of Human H6PD NP_0042760 |
| Description | Rabbit Polyclonal |
| Gene | PGLS |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lung tissue labelling H6PD with ab84353 at 1/100. A Cy3-conjugated donkey anti-rabbit IgG (1/200) was used as the secondary antibody. Positive staining shown in the cytoplasm of alveolar type I cells. Magnification: 20X. Exposure time: 0.5 - 2.0 seconds. Left - DAPI. Middle - H6PD. Right - Merge.
Anti-H6PD antibody (ab84353) at 1 µg/ml + 721_B cell lysate at 10 µgSecondaryanti-Rabbit IgG HRP at 1/50000 dilution