Anti-HAPLN1 antibody
| Name | Anti-HAPLN1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98038 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 35-84 ( ENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKL ) of Human HAPLN1 (NP_001875) |
| Description | Rabbit Polyclonal |
| Gene | HAPLN1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-HAPLN1 antibody (ab98038) at 1 µg/ml (in 5% skim milk / PBS buffer) + NCI-H226 Cell Lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution