Name | Anti-HAUS3 antibody |
---|---|
Supplier | Abcam |
Catalog | ab136628 |
Prices | $359.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Rat, Guinea Pig |
Antigen | Synthetic peptide corresponding to a region within internal amino acids 291-340 ( KWAEESLHSLTSKAVDKENLDAKISSLTSEIMKLEKEVTQIKDRSLPAVV ) of Human HAUS3 (NM_024511) |
Description | Rabbit Polyclonal |
Gene | HAUS3 |
Conjugate | Unconjugated |
Supplier Page | Shop |