Anti-HAUS3 antibody
| Name | Anti-HAUS3 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab136628 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rat, Guinea Pig |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 291-340 ( KWAEESLHSLTSKAVDKENLDAKISSLTSEIMKLEKEVTQIKDRSLPAVV ) of Human HAUS3 (NM_024511) |
| Description | Rabbit Polyclonal |
| Gene | HAUS3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-HAUS3 antibody (ab136628) at 1 µg/ml + Jurkat cell lysate at 10 µg