Anti-HIBADH antibody
| Name | Anti-HIBADH antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab84591 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 251-300 ( WSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPIL ) of Human HIBADH (NP_689953) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | HIBADH |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-HIBADH antibody (ab84591) at 1 µg/ml + Human fetal liver lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution