Anti-Homez antibody
| Name | Anti-Homez antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab82867 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ELISA WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 72-121 ( KTFSYFPYPSLADIALLCLRYGLQMEKVKTWFMAQRLRCGISWSSEEIEE ) of human HOMEZ (NP_065885) |
| Description | Rabbit Polyclonal |
| Gene | HOMEZ |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Homez antibody (ab82867) at 1 µg/ml (in 5% skim milk / PBS buffer) + 721_B cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG diluted in 1/50000 - 1/100000 as secondary antibody.