Anti-HOX11 antibody
| Name | Anti-HOX11 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab94528 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Guinea Pig, Bovine, Dog |
| Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 2-51 ( EHLGPHHLHPGHAEPISFGIDQILNSPDQGGCMGPASRLQDGEYGLGCLV ) of Human HOX11 (NP_005512) |
| Description | Rabbit Polyclonal |
| Gene | TLX1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-HOX11 antibody (ab94528) at 1 µg/ml + 721_B cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution