Anti-HSPA4L antibody
| Name | Anti-HSPA4L antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81221 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ELISA WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide, corresponding to a region within C terminal amino acids 720-769 ( RNKDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVS ) of human HSPA4L (NP_055093) |
| Description | Rabbit Polyclonal |
| Gene | HSPA4L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-HSPA4L antibody (ab81221) at 1 µg/ml (in 5% skim milk / PBS buffer) + fetal brain lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution