Name | Anti-htrA4 antibody |
---|---|
Supplier | Abcam |
Catalog | ab84894 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Pig |
Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 396-445 ( LKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTD ) of Human htrA4 (NP_710159) |
Description | Rabbit Polyclonal |
Gene | HTRA4 |
Conjugate | Unconjugated |
Supplier Page | Shop |