Anti-IDH2 antibody
| Name | Anti-IDH2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab84726 |
| Prices | $385.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB ICC/IF ICC/IF |
| Species Reactivities | Human, Zebrafish, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig, Yeast, C. elegans |
| Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 143-192 (GGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTF K) of Human IDH2 (NP_002159) |
| Blocking Peptide | Human IDH2 peptide |
| Description | Rabbit Polyclonal |
| Gene | IDH2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-IDH2 antibody (ab84726) at 1 µg/ml + Human fetal muscle lysate at 10 µgSecondaryanti-Rabbit IgG HRP at 1/50000 dilution
ICC/IF image of ab84726 stained HepG2 cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab84726, 5µg/ml) overnight at +4°C. The secondary antibody (green) was ab96899, DyLight® 488 goat anti-rabbit IgG (H+L) used at a 1/250 dilution for 1h.Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.
IHC image of ab84726 staining in Hu Colon formalin fixed paraffin embedded tissue section, performed on a Leica BondTM system using the standard protocol F. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH6, epitope retrieval solution 1) for 20 mins. The section was then incubated with ab84726, 5µg/ml, for 15 mins at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX.For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.
All lanes : Anti-IDH2 antibody (ab84726) at 1 µg/mlLane 1 : MarkerLane 2 : Zebrafish skeletal muscle homogenate (20ug)Lane 3 : JURKAT (Human T cell lymphoblast-like cell line) Whole Cell Lysate (20ug)SecondaryGoat polyclonal to Rabbit IgG – H&L – Pre-Adsorbed (HRP) at 1/6000 dilutiondeveloped using the ECL techniquePerformed under reducing conditions.
Anti-IDH2 antibody (ab84726) at 1/1000 dilution + rat proximal kidney tubules purified from the cortex at 1 µg/ml
Product References
Mutant IDH inhibits HNF-4alpha to block hepatocyte differentiation and promote - Mutant IDH inhibits HNF-4alpha to block hepatocyte differentiation and promote
Saha SK, Parachoniak CA, Ghanta KS, Fitamant J, Ross KN, Najem MS, Gurumurthy S, Akbay EA, Sia D, Cornella H, Miltiadous O, Walesky C, Deshpande V, Zhu AX, Hezel AF, Yen KE, Straley KS, Travins J, Popovici-Muller J, Gliser C, Ferrone CR, Apte U, Llovet JM, Wong KK, Ramaswamy S, Bardeesy N. Nature. 2014 Sep 4;513(7516):110-4.
Elevated CO(2) levels cause mitochondrial dysfunction and impair cell - Elevated CO(2) levels cause mitochondrial dysfunction and impair cell
Vohwinkel CU, Lecuona E, Sun H, Sommer N, Vadasz I, Chandel NS, Sznajder JI. J Biol Chem. 2011 Oct 28;286(43):37067-76.