Anti-IER5 antibody
| Name | Anti-IER5 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab97939 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Guinea Pig, Bovine, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 1-50 (MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLS D) of Human IER5 (NP_057629) |
| Description | Rabbit Polyclonal |
| Gene | IER5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-IER5 antibody (ab97939) at 1 µg/ml + HepG2 cell lysate at 10 µg with 5% skim milk in PBS bufferSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution