Name | Anti-IER5 antibody |
---|---|
Supplier | Abcam |
Catalog | ab97939 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Guinea Pig, Bovine, Zebrafish |
Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 1-50 (MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLS D) of Human IER5 (NP_057629) |
Description | Rabbit Polyclonal |
Gene | IER5 |
Conjugate | Unconjugated |
Supplier Page | Shop |