Anti-IFFO antibody
| Name | Anti-IFFO antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab108177 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within C-terminal amino acids 151-200 (VQMETCRRLITQSGDRKSPAFTAVPLSDPPPPPSEAEDSDRDVSSDSSM R) of Human IFFO (NM_080731) |
| Description | Rabbit Polyclonal |
| Gene | IFFO1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-IFFO antibody (ab108177) at 1 µg/ml + HeLa cell lysate at 10 µg