Anti-IFN gamma Receptor beta antibody

Name Anti-IFN gamma Receptor beta antibody
Supplier Abcam
Catalog ab84524
Prices $378.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide corresponding to a region within the internal sequence amino acids 179-228 (WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGH L) of human IFN gamma Receptor beta (NP_005525)
Description Rabbit Polyclonal
Gene IFNGR2
Conjugate Unconjugated
Supplier Page Shop

Product images


Product References