Anti-IFN gamma Receptor beta antibody
| Name | Anti-IFN gamma Receptor beta antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab84524 |
| Prices | $378.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 179-228 (WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGH L) of human IFN gamma Receptor beta (NP_005525) |
| Description | Rabbit Polyclonal |
| Gene | IFNGR2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-IFN gamma Receptor beta antibody (ab84524) at 1 µg/ml + Human Fetal Liver lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1: 50,000