Anti-IFNA4 antibody
| Name | Anti-IFNA4 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab135258 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 140-189 ( ILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD ) of Human IFNA4 (NP_066546) |
| Description | Rabbit Polyclonal |
| Gene | IFNA4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-IFNA4 antibody (ab135258) at 1 µg/ml + Human fetal stomach lysate at 10 µg