Anti-IL21 Receptor antibody
| Name | Anti-IL21 Receptor antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab13268 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ELISA FC IHC-P |
| Species Reactivities | Mouse, Human, Rat |
| Antigen | Synthetic peptide: CVLETRSPNPSILSLTWQDEYEELQDQETF , corresponding to N-term amino acids 35-65 of Mouse IL21 Receptor |
| Description | Rabbit Polyclonal |
| Gene | IL21R |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Immunohistochemistry on mouse thymus with rabbit antibody to N-terminus of mouse IL-21 receptor.
Product References
IL-21 and IL-21 receptor expression in lymphocytes and neurons in multiple - IL-21 and IL-21 receptor expression in lymphocytes and neurons in multiple
Tzartos JS, Craner MJ, Friese MA, Jakobsen KB, Newcombe J, Esiri MM, Fugger L. Am J Pathol. 2011 Feb;178(2):794-802.
IL-21 induces apoptosis of antigen-specific CD8+ T lymphocytes. - IL-21 induces apoptosis of antigen-specific CD8+ T lymphocytes.
Barker BR, Parvani JG, Meyer D, Hey AS, Skak K, Letvin NL. J Immunol. 2007 Sep 15;179(6):3596-603.
CD25+ regulatory T cell depletion augments immunotherapy of micrometastases by an - CD25+ regulatory T cell depletion augments immunotherapy of micrometastases by an
Comes A, Rosso O, Orengo AM, Di Carlo E, Sorrentino C, Meazza R, Piazza T, Valzasina B, Nanni P, Colombo MP, Ferrini S. J Immunol. 2006 Feb 1;176(3):1750-8.