Anti-IL21 Receptor antibody
| Name | Anti-IL21 Receptor antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab13321 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Goat |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P ELISA |
| Species Reactivities | Human, Rat |
| Antigen | Synthetic peptide: CILEMWNLHPSTLTLTWQDQYEELKDEATS , corresponding to N-term amino acids 35-65 of Human IL21 Receptor |
| Description | Goat Polyclonal |
| Gene | IL21R |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
ab13321 used in IHC staining human lung at 1/300 dilution.