Anti-Insig2 antibody
| Name | Anti-Insig2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86415 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Human, Rat, Sheep, Rabbit, Goat, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig, Zebrafish |
| Antigen | A synthetic peptide corresponding to a region within amino acids 72-121 ( WVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHA ) of Human Insig2 (NP_057217) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | INSIG2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Insig2 antibody (ab86415) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal muscle lysate at 10 µgSecondaryHRP-conjugated anti-Rabbit IgG at 1/50000 dilution