Anti-Integrin alpha 3a antibody [29A3]
| Name | Anti-Integrin alpha 3a antibody [29A3] |
|---|---|
| Supplier | Abcam |
| Catalog | ab8985 |
| Prices | $370.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG1 |
| Clone | 29A3 |
| Applications | IHC-F ICC/IF WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide: C-RTRALYEAKRQKAEMKSQPSETERLTDDY conjugated to KLH |
| Description | Mouse Monoclonal |
| Gene | ITGA3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Immunohistochemistry on frozen section of human kidney