Anti-IQCD antibody
| Name | Anti-IQCD antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab104880 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 2-51 ALDILAMAPLYQAPAINRIGPKTDPSKRPADPLKPLVLSRTKLTTIEAKR of Human IQCD, accession number NP_612460 Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | IQCD |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-IQCD antibody (ab104880) at 1 µg/ml + Fetal heart lysate at 10 µg