Anti-IRTA2 antibody
| Name | Anti-IRTA2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab133915 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 866-915 ( ALLLYCWLSRKAGRKPASDPARSPSDSDSQEPTYHNVPAWEELQPVYTNA ) of Human IRTA2 (NP_112571) |
| Description | Rabbit Polyclonal |
| Gene | FCRL5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-IRTA2 antibody (ab133915) at 1 µg/ml + Human fetal small intestine lysate at 10 µg