Anti-KANK3 antibody
| Name | Anti-KANK3 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab90014 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Guinea Pig, Bovine, Dog |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 2 - 51 ( AKFALNQNLPDLGGPRLCPVPAAGGARSPSSPYSVETPYGFHLDLDFLKY ) of Human KANK3 (NP_940873) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | KANK3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-KANK3 antibody (ab90014) at 1 µg/ml (in 5% skim milk / PBS buffer) + human fetal heart lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution