Anti-KAT13C / NCOA2 antibody
| Name | Anti-KAT13C / NCOA2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab94502 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 2-51 ( SGMGENTSDPSRAETRKRKECPDQLGPSPKRNTEKRNREQENKYIEELAE ) of Human KAT13C/ NCOA2 (NP_006531) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | NCOA2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-KAT13C / NCOA2 antibody (ab94502) at 1 µg/ml + Fetal thymus lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution